DPP3 antibody (N-Term)
-
- Target See all DPP3 Antibodies
- DPP3 (Dipeptidyl-Peptidase 3 (DPP3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DPP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DPP3 antibody was raised against the N terminal of DPP3
- Purification
- Affinity purified
- Immunogen
- DPP3 antibody was raised using the N terminal of DPP3 corresponding to a region with amino acids SRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEE
- Top Product
- Discover our top product DPP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DPP3 Blocking Peptide, catalog no. 33R-8738, is also available for use as a blocking control in assays to test for specificity of this DPP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPP3 (Dipeptidyl-Peptidase 3 (DPP3))
- Alternative Name
- DPP3 (DPP3 Products)
- Background
- DPP3 is a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers.
- Molecular Weight
- 82 kDa (MW of target protein)
-