FAM119A antibody (N-Term)

Catalog No. ABIN632190

Product Details anti-FAM119A Antibody

Target: FAM119A (Family With Sequence Similarity 119A (FAM119A))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM119A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM119 A antibody was raised against the N terminal of FAM119

Purification: Affinity purified

Immunogen: FAM119 A antibody was raised using the N terminal of FAM119 corresponding to a region with amino acids ALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM119A Blocking Peptide, catalog no. 33R-1379, is also available for use as a blocking control in assays to test for specificity of this FAM119A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM119A

Target: FAM119A (Family With Sequence Similarity 119A (FAM119A))

Alternative Name: FAM119A (FAM119A Products)

Synonyms: 2310038H17Rik antibody, AI464204 antibody, Fam119a antibody, FAM119A antibody, HCA557b antibody, zgc:110528 antibody, RGD1311824 antibody, methyltransferase like 21A antibody, Mettl21a antibody, METTL21A antibody, mettl21a antibody

Background: FAM119A is a multi-pass membrane protein. It belongs to the FAM119 family. The function of the FAM119A protein remains unknown.

Molecular Weight: 24 kDa (MW of target protein)