STK32A antibody (N-Term)

Catalog No. ABIN632177

Product Details anti-STK32A Antibody

Target: STK32A (serine/threonine Kinase 32A (STK32A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STK32A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STK32 A antibody was raised against the N terminal of STK32

Purification: Affinity purified

Immunogen: STK32 A antibody was raised using the N terminal of STK32 corresponding to a region with amino acids GANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STK32A Blocking Peptide, catalog no. 33R-3165, is also available for use as a blocking control in assays to test for specificity of this STK32A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STK32A

Target: STK32A (serine/threonine Kinase 32A (STK32A))

Alternative Name: STK32A (STK32A Products)

Synonyms: YANK1 antibody, A930015B13Rik antibody, serine/threonine kinase 32A antibody, STK32A antibody, Stk32a antibody

Background: STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.

Molecular Weight: 20 kDa (MW of target protein)