Tektin 4 antibody (N-Term)

Catalog No. ABIN632168

Product Details anti-Tektin 4 Antibody

Target: Tektin 4 (TEKT4)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tektin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tektin 4 antibody was raised against the N terminal of TEKT4

Purification: Affinity purified

Immunogen: Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tektin 4 Blocking Peptide, catalog no. 33R-4802, is also available for use as a blocking control in assays to test for specificity of this Tektin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEKT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tektin 4

Target: Tektin 4 (TEKT4)

Alternative Name: Tektin 4 (TEKT4 Products)

Synonyms: ECGP antibody, GP96 antibody, GRP94 antibody, TRA1 antibody, 1700010L19Rik antibody, RGD1308075 antibody, Tek4 antibody, Tektin4 antibody, Tekt4 antibody, heat shock protein 90 beta family member 1 antibody, tektin 4 antibody, tektin-4 antibody, tektin 4 S homeolog antibody, HSP90B1 antibody, Tekt4 antibody, TEKT4 antibody, LOC490081 antibody, tekt4.S antibody, tekt4 antibody, LOC100719827 antibody, LOC110259951 antibody

Background: TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.

Molecular Weight: 51 kDa (MW of target protein)