C14orf174 antibody (N-Term)

Catalog No. ABIN632166

Product Details anti-C14orf174 Antibody

Target: C14orf174 (Chromosome 14 Open Reading Frame 174 (C14orf174))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C14orf174 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C14 ORF174 antibody was raised against the N terminal Of C14 rf174

Purification: Affinity purified

Immunogen: C14 ORF174 antibody was raised using the N terminal Of C14 rf174 corresponding to a region with amino acids FPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTEPPEQARLEFL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF174 Blocking Peptide, catalog no. 33R-3024, is also available for use as a blocking control in assays to test for specificity of this C14ORF174 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF174 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C14orf174

Target: C14orf174 (Chromosome 14 Open Reading Frame 174 (C14orf174))

Alternative Name: C14ORF174 (C14orf174 Products)

Synonyms: C14orf174 antibody, FAM15A antibody, Gm263 antibody, sterile alpha motif domain containing 15 antibody, SAMD15 antibody, Samd15 antibody

Background: C14orf174 contains 1 SAM (sterile alpha motif) domain. The exact functions of C14orf174 remain unknown.

Molecular Weight: 77 kDa (MW of target protein)