IFIT3 antibody (N-Term)
-
- Target See all IFIT3 Antibodies
- IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IFIT3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- IFIT3 antibody was raised against the N terminal of IFIT3
- Purification
- Affinity purified
- Immunogen
- IFIT3 antibody was raised using the N terminal of IFIT3 corresponding to a region with amino acids ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY
- Top Product
- Discover our top product IFIT3 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IFIT3 Blocking Peptide, catalog no. 33R-1568, is also available for use as a blocking control in assays to test for specificity of this IFIT3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))
- Alternative Name
- IFIT3 (IFIT3 Products)
- Background
- IFIT3 is involved in protein binding.
- Molecular Weight
- 56 kDa (MW of target protein)
-