IFIT3 antibody (N-Term)

Catalog No. ABIN632163

Product Details anti-IFIT3 Antibody

Target: IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFIT3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: IFIT3 antibody was raised against the N terminal of IFIT3

Purification: Affinity purified

Immunogen: IFIT3 antibody was raised using the N terminal of IFIT3 corresponding to a region with amino acids ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFIT3 Blocking Peptide, catalog no. 33R-1568, is also available for use as a blocking control in assays to test for specificity of this IFIT3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFIT3

Target: IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))

Alternative Name: IFIT3 (IFIT3 Products)

Synonyms: DKFZp469G2233 antibody, CIG-49 antibody, GARG-49 antibody, IFI60 antibody, IFIT4 antibody, IRG2 antibody, ISG60 antibody, P60 antibody, RIG-G antibody, Ifi49 antibody, P49 antibody, IFIT-3 antibody, interferon induced protein with tetratricopeptide repeats 3 antibody, interferon-induced protein with tetratricopeptide repeats 3 antibody, IFIT3 antibody, Ifit3 antibody

Background: IFIT3 is involved in protein binding.

Molecular Weight: 56 kDa (MW of target protein)