ERP44 antibody
-
- Target See all ERP44 Antibodies
- ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ERP44 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE
- Top Product
- Discover our top product ERP44 Primary Antibody
-
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 1-406) antibody
ERP44 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibodyERP44 Reactivity: Human WB, ELISA, IHC (p), IP Host: Mouse Monoclonal 3C7 unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (Internal Region) antibodyERP44 Reactivity: Human, Mouse, Rat, Rabbit, Cow, Dog, Horse, Monkey, Guinea Pig, Pig, Bat, Chicken, Xenopus laevis IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-407) antibodyERP44 Reactivity: Human WB, IHC, ELISA, IHC (p), IP Host: Mouse Monoclonal 3C7 unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) antibodyERP44 Reactivity: Human, Mouse WB, IHC, ELISA Host: Rabbit Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) antibodyERP44 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (Internal Region) antibodyVerified ERP44 Reactivity: Human WB, ELISA Host: Goat Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (C-Term) antibodyERP44 Reactivity: Human, Mouse, Rat, Guinea Pig, Pig, Zebrafish (Danio rerio) WB Host: Rabbit Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 57-406) antibodyERP44 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (C-Term) antibodyERP44 Reactivity: Human IHC (p) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TXNDC4 Blocking Peptide, catalog no. 33R-5025, is also available for use as a blocking control in assays to test for specificity of this TXNDC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))
- Alternative Name
- TXNDC4 (ERP44 Products)
- Synonyms
- PDIA10 antibody, TXNDC4 antibody, 1110001E24Rik antibody, AI849526 antibody, AL033348 antibody, Txndc4 antibody, BWK4 antibody, txndc4 antibody, zgc:77883 antibody, endoplasmic reticulum protein 44 antibody, ERP44 antibody, Erp44 antibody, erp44 antibody
- Background
- TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis, SARS-CoV-2 Protein Interactome
-
