ITPK1 antibody (N-Term)

Catalog No. ABIN632148

Product Details anti-ITPK1 Antibody

Target: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITPK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ITPK1 antibody was raised against the N terminal of ITPK1

Purification: Affinity purified

Immunogen: ITPK1 antibody was raised using the N terminal of ITPK1 corresponding to a region with amino acids MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ITPK1 Blocking Peptide, catalog no. 33R-5984, is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITPK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITPK1

Target: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Alternative Name: ITPK1 (ITPK1 Products)

Synonyms: ITRPK1 antibody, BC031182 antibody, wu:fj15d08 antibody, zgc:56075 antibody, inositol-tetrakisphosphate 1-kinase antibody, inositol 1,3,4-triphosphate 5/6 kinase antibody, inositol-tetrakisphosphate 1-kinase L homeolog antibody, inositol-tetrakisphosphate 1-kinase a antibody, ITPK1 antibody, Itpk1 antibody, itpk1.L antibody, itpk1a antibody

Background: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. It probably acts as the rate-limiting enzyme of the InsP6 pathway. ITPK1 modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.

Molecular Weight: 45 kDa (MW of target protein)