ITPK1 antibody (N-Term)
-
- Target See all ITPK1 Antibodies
- ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ITPK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ITPK1 antibody was raised against the N terminal of ITPK1
- Purification
- Affinity purified
- Immunogen
- ITPK1 antibody was raised using the N terminal of ITPK1 corresponding to a region with amino acids MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI
- Top Product
- Discover our top product ITPK1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ITPK1 Blocking Peptide, catalog no. 33R-5984, is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITPK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))
- Alternative Name
- ITPK1 (ITPK1 Products)
- Background
- ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. It probably acts as the rate-limiting enzyme of the InsP6 pathway. ITPK1 modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.
- Molecular Weight
- 45 kDa (MW of target protein)
-