RPESP antibody (Middle Region)
-
- Target See all RPESP (C8orf84) products
- RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))
-
Binding Specificity
- Middle Region
-
Reactivity
- Mouse, Rat, Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPESP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPESP antibody was raised against the middle region of RPESP
- Purification
- Affinity purified
- Immunogen
- RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPESP Blocking Peptide, catalog no. 33R-5349, is also available for use as a blocking control in assays to test for specificity of this RPESP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPESP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))
- Alternative Name
- RPESP (C8orf84 Products)
- Synonyms
- C8orf84 antibody, RPESP antibody, C14H8orf84 antibody, Gm106 antibody, Rpesp antibody, RGD1559717 antibody, RPE-spondin antibody, somatomedin B and thrombospondin type 1 domain containing antibody, somatomedin B and thrombospondin, type 1 domain containing antibody, Tsp_04711 antibody, SBSPON antibody, Sbspon antibody
- Background
- RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.
- Molecular Weight
- 29 kDa (MW of target protein)
-