MAT2B antibody (N-Term)

Catalog No. ABIN632144

Product Details anti-MAT2B Antibody

Target: MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAT2B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAT2 B antibody was raised against the N terminal of MAT2

Purification: Affinity purified

Immunogen: MAT2 B antibody was raised using the N terminal of MAT2 corresponding to a region with amino acids KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAT2B Blocking Peptide, catalog no. 33R-4332, is also available for use as a blocking control in assays to test for specificity of this MAT2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAT2B

Target: MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))

Alternative Name: MAT2B (MAT2B Products)

Synonyms: MAT-II antibody, MATIIbeta antibody, Nbla02999 antibody, SDR23E1 antibody, TGR antibody, 1110064C04Rik antibody, 2410018D16Rik antibody, AI182287 antibody, AU022853 antibody, fc55d01 antibody, wu:fb48h02 antibody, wu:fc55d01 antibody, zgc:110308 antibody, MAT2beta antibody, methionine adenosyltransferase 2B antibody, methionine adenosyltransferase II, beta antibody, methionine adenosyltransferase II, beta L homeolog antibody, MAT2B antibody, Mat2b antibody, mat2b antibody, mat2b.L antibody

Background: MAT2B belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process, SARS-CoV-2 Protein Interactome