PRMT7 antibody (N-Term)
-
- Target See all PRMT7 Antibodies
- PRMT7 (Protein Arginine Methyltransferase 7 (PRMT7))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRMT7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRMT7 antibody was raised against the N terminal of PRMT7
- Purification
- Affinity purified
- Immunogen
- PRMT7 antibody was raised using the N terminal of PRMT7 corresponding to a region with amino acids MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ
- Top Product
- Discover our top product PRMT7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRMT7 Blocking Peptide, catalog no. 33R-6141, is also available for use as a blocking control in assays to test for specificity of this PRMT7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRMT7 (Protein Arginine Methyltransferase 7 (PRMT7))
- Alternative Name
- PRMT7 (PRMT7 Products)
- Synonyms
- ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 7 antibody, ATPRMT7 antibody, DL4310W antibody, FCAALL.195 antibody, protein arginine methyltransferase 7 antibody, RGD1304869 antibody, 4933402B05Rik antibody, BC006705 antibody, zgc:66172 antibody, protein arginine methyltransferase 7 antibody, protein arginine methyltransferase 7 L homeolog antibody, protein arginine N-methyltransferase 7 antibody, Protein arginine N-methyltransferase 7 antibody, PRMT7 antibody, Prmt7 antibody, prmt7.L antibody, prmt7 antibody, prmt-7 antibody
- Background
- Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing.
- Molecular Weight
- 78 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-