CCT8 antibody

Catalog No. ABIN632135

Product Details anti-CCT8 Antibody

Target: CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCT8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCT8 Blocking Peptide, catalog no. 33R-2076, is also available for use as a blocking control in assays to test for specificity of this CCT8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCT8

Target: CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))

Alternative Name: CCT8 (CCT8 Products)

Synonyms: CCT8 antibody, DKFZp469C2223 antibody, MGC89698 antibody, C21orf112 antibody, Cctq antibody, D21S246 antibody, PRED71 antibody, AI132397 antibody, Tcpq antibody, fa22h09 antibody, wu:fa22h09 antibody, zgc:56059 antibody, chaperonin containing TCP1 subunit 8 antibody, chaperonin containing TCP1, subunit 8 (theta) antibody, chaperonin containing Tcp1, subunit 8 (theta) antibody, chaperonin containing TCP1 subunit 8 L homeolog antibody, Chaperonin Containing TCP-1 antibody, CCT8 antibody, cct8 antibody, Cct8 antibody, cct8.L antibody, cct-8 antibody

Background: As a molecular chaperone, CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.

Molecular Weight: 59 kDa (MW of target protein)