VGLL3 antibody
-
- Target See all VGLL3 Antibodies
- VGLL3 (Vestigial Like 3 (VGLL3))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VGLL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- VGLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY
- Top Product
- Discover our top product VGLL3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VGLL3 Blocking Peptide, catalog no. 33R-1663, is also available for use as a blocking control in assays to test for specificity of this VGLL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VGLL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VGLL3 (Vestigial Like 3 (VGLL3))
- Alternative Name
- VGLL3 (VGLL3 Products)
- Synonyms
- RGD1560030 antibody, VGL-3 antibody, VGL3 antibody, 1700110N18Rik antibody, 4832416J22 antibody, C80713 antibody, Vgl-3 antibody, Vito-2 antibody, vestigial-like family member 3 antibody, vestigial like family member 3 antibody, Vgll3 antibody, VGLL3 antibody
- Background
- VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.
- Molecular Weight
- 36 kDa (MW of target protein)
-