Adenylate Kinase 5 antibody (N-Term)
-
- Target See all Adenylate Kinase 5 (AK5) Antibodies
- Adenylate Kinase 5 (AK5)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Adenylate Kinase 5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AK5 antibody was raised against the N terminal of AK5
- Purification
- Affinity purified
- Immunogen
- AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY
- Top Product
- Discover our top product AK5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AK5 Blocking Peptide, catalog no. 33R-2721, is also available for use as a blocking control in assays to test for specificity of this AK5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Adenylate Kinase 5 (AK5)
- Alternative Name
- AK5 (AK5 Products)
- Synonyms
- AK6 antibody, AK 5 antibody, wu:fj63a06 antibody, adenylate kinase 5 antibody, AK5 antibody, Ak5 antibody, ADK5 antibody, ak5 antibody
- Background
- This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
- Molecular Weight
- 62 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-