CCDC138 antibody (N-Term)

Catalog No. ABIN632125

Product Details anti-CCDC138 Antibody

Target: CCDC138 (Coiled-Coil Domain Containing 138 (CCDC138))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC138 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC138 antibody was raised against the N terminal of CCDC138

Purification: Affinity purified

Immunogen: CCDC138 antibody was raised using the N terminal of CCDC138 corresponding to a region with amino acids EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC138 Blocking Peptide, catalog no. 33R-2646, is also available for use as a blocking control in assays to test for specificity of this CCDC138 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC138 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC138

Target: CCDC138 (Coiled-Coil Domain Containing 138 (CCDC138))

Alternative Name: CCDC138 (CCDC138 Products)

Synonyms: 6230424H07Rik antibody, BC042726 antibody, MGC115290 antibody, RGD1566050 antibody, coiled-coil domain containing 138 antibody, coiled-coil domain containing 138 L homeolog antibody, Ccdc138 antibody, CCDC138 antibody, ccdc138.L antibody, ccdc138 antibody

Background: The function of the CCDC138 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 76 kDa (MW of target protein)

Pathways: BCR Signaling