UFSP2 antibody (Middle Region)
-
- Target See all UFSP2 (C4orf20) Antibodies
- UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UFSP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C4 ORF20 antibody was raised against the middle region of C4 rf20
- Purification
- Affinity purified
- Immunogen
- C4 ORF20 antibody was raised using the middle region of C4 rf20 corresponding to a region with amino acids TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC
- Top Product
- Discover our top product C4orf20 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C4ORF20 Blocking Peptide, catalog no. 33R-9238, is also available for use as a blocking control in assays to test for specificity of this C4ORF20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))
- Alternative Name
- C4ORF20 (C4orf20 Products)
- Synonyms
- C4orf20 antibody, 1810047C23Rik antibody, RGD1311161 antibody, cb891 antibody, fb05c06 antibody, fk89d04 antibody, wu:fb05c06 antibody, wu:fk89d04 antibody, zgc:64113 antibody, UFM1 specific peptidase 2 antibody, UFM1-specific peptidase 2 antibody, UFM1-specific peptidase 2 L homeolog antibody, ufm1-specific peptidase 2 antibody, UFSP2 antibody, Ufsp2 antibody, ufsp2.L antibody, ufsp2 antibody
- Background
- C4ORF20 is a thiol protease which recognises and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, an ubiquitin-like modifier protein bound to a number of target proteins. Does not hydrolyze SUMO1 or ISG15 ubiquitin-like proteins.
- Molecular Weight
- 53 kDa (MW of target protein)
-