PGM2L1 antibody (N-Term)

Catalog No. ABIN632120

Product Details anti-PGM2L1 Antibody

Target: PGM2L1 (phosphoglucomutase 2-Like 1 (PGM2L1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PGM2L1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PGM2 L1 antibody was raised against the N terminal of PGM2 1

Purification: Affinity purified

Immunogen: PGM2 L1 antibody was raised using the N terminal of PGM2 1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGM2L1 Blocking Peptide, catalog no. 33R-4321, is also available for use as a blocking control in assays to test for specificity of this PGM2L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PGM2L1

Target: PGM2L1 (phosphoglucomutase 2-Like 1 (PGM2L1))

Alternative Name: PGM2L1 (PGM2L1 Products)

Synonyms: 4931406N15Rik antibody, AI553438 antibody, BM32A antibody, im:7140576 antibody, zgc:198285 antibody, pgm2l1 antibody, phosphoglucomutase 2-like 1 antibody, phosphoglucomutase 2 like 1 antibody, phosphoglucomutase 2-like 1 L homeolog antibody, Pgm2l1 antibody, PGM2L1 antibody, pgm2l1 antibody, pgm2l1.L antibody

Background: PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.

Molecular Weight: 70 kDa (MW of target protein)