SSBP3 antibody (Middle Region)

Catalog No. ABIN632119

Product Details anti-SSBP3 Antibody

Target: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SSBP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SSBP3 antibody was raised against the middle region of SSBP3

Purification: Affinity purified

Immunogen: SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SSBP3 Blocking Peptide, catalog no. 33R-1990, is also available for use as a blocking control in assays to test for specificity of this SSBP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SSBP3

Target: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Alternative Name: SSBP3 (SSBP3 Products)

Background: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Molecular Weight: 38 kDa (MW of target protein)