SSBP3 antibody (Middle Region)

Catalog No. ABIN632119

Product Details anti-SSBP3 Antibody

Target: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SSBP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SSBP3 antibody was raised against the middle region of SSBP3

Purification: Affinity purified

Immunogen: SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SSBP3 Blocking Peptide, catalog no. 33R-1990, is also available for use as a blocking control in assays to test for specificity of this SSBP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SSBP3

Target: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Alternative Name: SSBP3 (SSBP3 Products)

Synonyms: ssbp3 antibody, MGC75859 antibody, SSBP3 antibody, SSDP1b antibody, si:dkey-63k7.6 antibody, csdp antibody, ssdp antibody, ssdp1 antibody, CSDP antibody, SSDP antibody, SSDP1 antibody, Ssdp antibody, Ssdp3 antibody, SSDP1a antibody, id:ibd1109 antibody, zgc:63791 antibody, 2610021L12Rik antibody, 2610200M23Rik antibody, 5730488C10Rik antibody, AI854733 antibody, AW551939 antibody, LAST antibody, single stranded DNA binding protein 3 antibody, single stranded DNA binding protein 3a antibody, single stranded DNA binding protein 3 L homeolog antibody, single stranded DNA binding protein 3b antibody, single-stranded DNA binding protein 3 antibody, ssbp3 antibody, SSBP3 antibody, ssbp3a antibody, ssbp3.L antibody, Ssbp3 antibody, ssbp3b antibody

Background: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Molecular Weight: 38 kDa (MW of target protein)