WDTC1 antibody (N-Term)

Catalog No. ABIN632114

Product Details anti-WDTC1 Antibody

Target: WDTC1 (Wdtc1) (WD and Tetratricopeptide Repeats 1 (Wdtc1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDTC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDTC1 antibody was raised against the N terminal of WDTC1

Purification: Affinity purified

Immunogen: WDTC1 antibody was raised using the N terminal of WDTC1 corresponding to a region with amino acids PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDTC1 Blocking Peptide, catalog no. 33R-7230, is also available for use as a blocking control in assays to test for specificity of this WDTC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDTC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDTC1

Target: WDTC1 (Wdtc1) (WD and Tetratricopeptide Repeats 1 (Wdtc1))

Alternative Name: WDTC1 (Wdtc1 Products)

Synonyms: fc31b01 antibody, wu:fc31b01 antibody, zgc:194983 antibody, ADP antibody, DCAF9 antibody, Gm695 antibody, adipose antibody, adp antibody, WD and tetratricopeptide repeats 1 antibody, WD and tetratricopeptide repeats 1 L homeolog antibody, WDTC1 antibody, wdtc1 antibody, wdtc1.L antibody, Wdtc1 antibody

Background: WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake.

Molecular Weight: 76 kDa (MW of target protein)