LIX1L antibody

Catalog No. ABIN632112

Product Details anti-LIX1L Antibody

Target: LIX1L (Lix1 Homolog Like (LIX1L))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIX1L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LIX1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIX1L Blocking Peptide, catalog no. 33R-1225, is also available for use as a blocking control in assays to test for specificity of this LIX1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIX0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIX1L

Target: LIX1L (Lix1 Homolog Like (LIX1L))

Alternative Name: LIX1L (LIX1L Products)

Synonyms: si:ch211-210h11.10 antibody, D130027M04Rik antibody, limb and CNS expressed 1 like antibody, Lix1-like antibody, lix1l antibody, LIX1L antibody, Lix1l antibody

Background: LIX1L may function as a modulator of fat signaling.

Molecular Weight: 36 kDa (MW of target protein)