FAM84A antibody (N-Term)

Catalog No. ABIN632110

Product Details anti-FAM84A Antibody

Target: FAM84A (Family with Sequence Similarity 84, Member A (FAM84A))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM84A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM84 A antibody was raised against the N terminal of FAM84

Purification: Affinity purified

Immunogen: FAM84 A antibody was raised using the N terminal of FAM84 corresponding to a region with amino acids GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM84A Blocking Peptide, catalog no. 33R-3455, is also available for use as a blocking control in assays to test for specificity of this FAM84A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM84A

Target: FAM84A (Family with Sequence Similarity 84, Member A (FAM84A))

Alternative Name: FAM84A (FAM84A Products)

Synonyms: 2310003N02Rik antibody, 4731402F03Rik antibody, AW125753 antibody, Nse1 antibody, NSE1 antibody, PP11517 antibody, RGD1305779 antibody, zgc:63724 antibody, family with sequence similarity 84, member A antibody, family with sequence similarity 84 member A antibody, Fam84a antibody, FAM84A antibody, fam84a antibody

Background: FAM84A belongs to the FAM84 family. Up-regulation of FAM84A may play a critical role in progression of colon cancer.

Molecular Weight: 32 kDa (MW of target protein)