Acylglycerol Kinase antibody (N-Term)

Catalog No. ABIN632105

Product Details anti-Acylglycerol Kinase Antibody

Target: Acylglycerol Kinase (AGK)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Acylglycerol Kinase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AGK antibody was raised against the N terminal of AGK

Purification: Affinity purified

Immunogen: AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AGK Blocking Peptide, catalog no. 33R-4482, is also available for use as a blocking control in assays to test for specificity of this AGK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Acylglycerol Kinase

Target: Acylglycerol Kinase (AGK)

Alternative Name: AGK (AGK Products)

Synonyms: mulk antibody, CATC5 antibody, CTRCT38 antibody, MTDPS10 antibody, MULK antibody, 2610037M15Rik antibody, 6720408I04Rik antibody, AI465370 antibody, Mulk antibody, RGD1562046 antibody, fi38e09 antibody, wu:fi38e09 antibody, zgc:55462 antibody, acylglycerol kinase antibody, acylglycerol kinase S homeolog antibody, AGK antibody, agk antibody, LOC100165096 antibody, Agk antibody, agk.S antibody

Background: AGK is a lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. AGK does not phosphorylate sphingosine. Overexpression of AGK increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.

Molecular Weight: 47 kDa (MW of target protein)