PPM1J antibody

Catalog No. ABIN632095

Product Details anti-PPM1J Antibody

Target: PPM1J (Protein Phosphatase 1J (PPM1J))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPM1J antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PPM1 J antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPM1J Blocking Peptide, catalog no. 33R-9070, is also available for use as a blocking control in assays to test for specificity of this PPM1J antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPM1J

Target: PPM1J (Protein Phosphatase 1J (PPM1J))

Alternative Name: PPM1J (PPM1J Products)

Synonyms: 2310008J22Rik antibody, PP2Czeta antibody, Ppp2cz antibody, PP2CZ antibody, PPP2CZ antibody, protein phosphatase 1J antibody, protein phosphatase, Mg2+/Mn2+ dependent 1J antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1J antibody, Ppm1j antibody, PPM1J antibody

Background: PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known.

Molecular Weight: 55 kDa (MW of target protein)