CNN1 antibody (N-Term)
-
- Target See all CNN1 Antibodies
- CNN1 (Calponin 1 (CNN1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CNN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Calponin 1 antibody was raised against the N terminal of CNN1
- Purification
- Affinity purified
- Immunogen
- Calponin 1 antibody was raised using the N terminal of CNN1 corresponding to a region with amino acids MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF
- Top Product
- Discover our top product CNN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Calponin 1 Blocking Peptide, catalog no. 33R-6495, is also available for use as a blocking control in assays to test for specificity of this Calponin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNN1 (Calponin 1 (CNN1))
- Alternative Name
- Calponin 1 (CNN1 Products)
- Synonyms
- CN antibody, CnnI antibody, SMCC antibody, Sm-Calp antibody, XclpH3 antibody, clpH3 antibody, cnn2 antibody, calponin 1 antibody, calponin 1, basic, smooth muscle L homeolog antibody, cnn1 antibody, Cnn1 antibody, CNN1 antibody, cnn1.L antibody
- Background
- CNN1 is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
- Molecular Weight
- 33 kDa (MW of target protein)
-