PLAC9 antibody (Middle Region)

Catalog No. ABIN632092

Product Details anti-PLAC9 Antibody

Target: PLAC9 (Placenta-Specific 9 (PLAC9))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLAC9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLAC9 antibody was raised against the middle region of PLAC9

Purification: Affinity purified

Immunogen: PLAC9 antibody was raised using the middle region of PLAC9 corresponding to a region with amino acids RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLAC9 Blocking Peptide, catalog no. 33R-8146, is also available for use as a blocking control in assays to test for specificity of this PLAC9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLAC9

Target: PLAC9 (Placenta-Specific 9 (PLAC9))

Alternative Name: PLAC9 (PLAC9 Products)

Synonyms: placenta-specific 9 antibody, placenta specific 9 antibody, Plac9 antibody, PLAC9 antibody

Background: The function of PLAC9 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 10 kDa (MW of target protein)