PLAC9 antibody (Middle Region)
-
- Target See all PLAC9 Antibodies
- PLAC9 (Placenta-Specific 9 (PLAC9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLAC9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PLAC9 antibody was raised against the middle region of PLAC9
- Purification
- Affinity purified
- Immunogen
- PLAC9 antibody was raised using the middle region of PLAC9 corresponding to a region with amino acids RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG
- Top Product
- Discover our top product PLAC9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PLAC9 Blocking Peptide, catalog no. 33R-8146, is also available for use as a blocking control in assays to test for specificity of this PLAC9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAC9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLAC9 (Placenta-Specific 9 (PLAC9))
- Alternative Name
- PLAC9 (PLAC9 Products)
- Synonyms
- placenta-specific 9 antibody, placenta specific 9 antibody, Plac9 antibody, PLAC9 antibody
- Background
- The function of PLAC9 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 10 kDa (MW of target protein)
-