FABP1 antibody (N-Term)

Catalog No. ABIN632091

Product Details anti-FABP1 Antibody

Target: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FABP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FABP1 antibody was raised against the N terminal of FABP1

Purification: Affinity purified

Immunogen: FABP1 antibody was raised using the N terminal of FABP1 corresponding to a region with amino acids MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FABP1 Blocking Peptide, catalog no. 33R-6421, is also available for use as a blocking control in assays to test for specificity of this FABP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FABP1

Target: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Alternative Name: FABP1 (FABP1 Products)

Synonyms: FABPL antibody, L-FABP antibody, KAT4 antibody, KATIV antibody, mitAAT antibody, Fabpl antibody, Fabplg antibody, SCP antibody, SCP. antibody, p14 antibody, FABP1 antibody, FABP antibody, LFABP antibody, liver antibody, fabp1 antibody, Fabp1 antibody, FABP-1 antibody, FABPpm antibody, mAspAT antibody, fatty acid binding protein 1 antibody, glutamic-oxaloacetic transaminase 2 antibody, fatty acid binding protein 1, liver antibody, fatty acid binding protein 1a, liver antibody, fatty acid-binding protein, liver antibody, FABP1 antibody, GOT2 antibody, Fabp1 antibody, fabp1a antibody, LOC100726384 antibody

Background: FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha