SPACA7 antibody (Middle Region)

Catalog No. ABIN632089

Product Details anti-SPACA7 Antibody

Target: SPACA7 (C13orf28) (Chromosome 13 Open Reading Frame 28 (C13orf28))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPACA7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C13 ORF28 antibody was raised against the middle region of C13 rf28

Purification: Affinity purified

Immunogen: C13 ORF28 antibody was raised using the middle region of C13 rf28 corresponding to a region with amino acids PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C13ORF28 Blocking Peptide, catalog no. 33R-7105, is also available for use as a blocking control in assays to test for specificity of this C13ORF28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPACA7

Target: SPACA7 (C13orf28) (Chromosome 13 Open Reading Frame 28 (C13orf28))

Alternative Name: C13ORF28 (C13orf28 Products)

Synonyms: C13orf28 antibody, 1700094C09Rik antibody, sperm acrosome associated 7 antibody, SPACA7 antibody, Spaca7 antibody

Background: The function of Chromosome 13 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 21 kDa (MW of target protein)