ZGPAT antibody (C-Term)
-
- Target See all ZGPAT Antibodies
- ZGPAT (Zinc Finger, CCCH-Type with G Patch Domain (ZGPAT))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZGPAT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZGPAT antibody was raised against the C terminal of ZGPAT
- Purification
- Affinity purified
- Immunogen
- ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
- Top Product
- Discover our top product ZGPAT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZGPAT Blocking Peptide, catalog no. 33R-1217, is also available for use as a blocking control in assays to test for specificity of this ZGPAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZGPAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZGPAT (Zinc Finger, CCCH-Type with G Patch Domain (ZGPAT))
- Alternative Name
- ZGPAT (ZGPAT Products)
- Synonyms
- zc3h9 antibody, gpatc6 antibody, gpatch6 antibody, zc3hdc9 antibody, GPATC6 antibody, GPATCH6 antibody, KIAA1847 antibody, ZC3H9 antibody, ZC3HDC9 antibody, ZIP antibody, 1500006I01Rik antibody, BC021513 antibody, RGD1310801 antibody, zgc:63730 antibody, zinc finger CCCH-type and G-patch domain containing antibody, zinc finger, CCCH-type with G-patch domain L homeolog antibody, zinc finger, CCCH-type with G-patch domain antibody, zinc finger, CCCH-type with G patch domain antibody, ZGPAT antibody, zgpat.L antibody, zgpat antibody, Zgpat antibody
- Background
- ZGPAT contains 1 C3H1-type zinc finger and 1 G-patch domain. The function of the ZGPAT protein is not known.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-