TPRG1 antibody (N-Term)

Catalog No. ABIN632078

Product Details anti-TPRG1 Antibody

Target: TPRG1 (Tumor Protein P63 Regulated 1 (TPRG1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPRG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM79 B antibody was raised against the N terminal Of Fam79

Purification: Affinity purified

Immunogen: FAM79 B antibody was raised using the N terminal Of Fam79 corresponding to a region with amino acids DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM79B Blocking Peptide, catalog no. 33R-2108, is also available for use as a blocking control in assays to test for specificity of this FAM79B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPRG1

Target: TPRG1 (Tumor Protein P63 Regulated 1 (TPRG1))

Alternative Name: FAM79B (TPRG1 Products)

Synonyms: Tprg antibody, Svap30 antibody, RGD1306226 antibody, MGC68514 antibody, MGC162933 antibody, zgc:162933 antibody, 5430420C16Rik antibody, Tprg1 antibody, FAM79B antibody, tumor protein p63 regulated 1 antibody, tumor protein p63 regulated 1 L homeolog antibody, transformation related protein 63 regulated antibody, Tprg1 antibody, tprg1.L antibody, TPRG1 antibody, tprg1 antibody, Tprg antibody

Background: The function of FAM79 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 31 kDa (MW of target protein)