Calpain S1 antibody (Middle Region)
-
- Target See all Calpain S1 (CAPNS1) Antibodies
- Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Calpain S1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Calpain 4 antibody was raised against the middle region of CAPNS1
- Purification
- Affinity purified
- Immunogen
- Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL
- Top Product
- Discover our top product CAPNS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Calpain 4 Blocking Peptide, catalog no. 33R-8169, is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPNS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))
- Alternative Name
- Calpain 4 (CAPNS1 Products)
- Synonyms
- 30K antibody, CALPAIN4 antibody, CANP antibody, CANPS antibody, CAPN4 antibody, CDPS antibody, CSS1 antibody, Capn4 antibody, CAPNS1 antibody, Capa-4 antibody, Capa4 antibody, D7Ertd146e antibody, MGC84330 antibody, capns1 antibody, cb616 antibody, wu:fb81g08 antibody, wu:fl09e04 antibody, zgc:110603 antibody, calpain small subunit 1 antibody, calpain, small subunit 1 antibody, calpain, small subunit 1 L homeolog antibody, calpain, small subunit 1 a antibody, CAPNS1 antibody, Capns1 antibody, capns1.L antibody, capns1a antibody
- Background
- Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes.
- Molecular Weight
- 29 kDa (MW of target protein)
- Pathways
- Apoptosis
-