NECAB3 antibody (Middle Region)
-
- Target See all NECAB3 Antibodies
- NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NECAB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NECAB3 antibody was raised against the middle region of NECAB3
- Purification
- Affinity purified
- Immunogen
- NECAB3 antibody was raised using the middle region of NECAB3 corresponding to a region with amino acids ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV
- Top Product
- Discover our top product NECAB3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NECAB3 Blocking Peptide, catalog no. 33R-2749, is also available for use as a blocking control in assays to test for specificity of this NECAB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))
- Alternative Name
- NECAB3 (NECAB3 Products)
- Synonyms
- Apba2bp antibody, APBA2BP antibody, NECAB3 antibody, EFCBP3 antibody, NIP1 antibody, STIP3 antibody, SYTIP2 antibody, XB51 antibody, dJ63M2.4 antibody, dJ63M2.5 antibody, 2900010M17Rik antibody, AI853434 antibody, Nip1 antibody, N-terminal EF-hand calcium binding protein 3 antibody, Necab3 antibody, NECAB3 antibody
- Background
- The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 44 kDa (MW of target protein)
-