DCUN1D1 antibody

Catalog No. ABIN632052

Product Details anti-DCUN1D1 Antibody

Target: DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCUN1D1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: DCUN1 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCUN1D1 Blocking Peptide, catalog no. 33R-8719, is also available for use as a blocking control in assays to test for specificity of this DCUN1D1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCUN0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCUN1D1

Target: DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))

Alternative Name: DCUN1D1 (DCUN1D1 Products)

Background: DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.

Molecular Weight: 28 kDa (MW of target protein)