DCUN1D1 antibody

Catalog No. ABIN632052

Product Details anti-DCUN1D1 Antibody

Target: DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCUN1D1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: DCUN1 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCUN1D1 Blocking Peptide, catalog no. 33R-8719, is also available for use as a blocking control in assays to test for specificity of this DCUN1D1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCUN0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCUN1D1

Target: DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))

Alternative Name: DCUN1D1 (DCUN1D1 Products)

Synonyms: fd19a01 antibody, zgc:66414 antibody, wu:fd19a01 antibody, dcun1l1 antibody, rp42 antibody, sccro antibody, scro antibody, tes3 antibody, DCNL1 antibody, DCUN1L1 antibody, RP42 antibody, SCCRO antibody, SCRO antibody, Tes3 antibody, Rp42 antibody, pTes3 antibody, DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) antibody, DCN1-like protein 1 antibody, DCN1, defective in cullin neddylation 1, domain containing 1 L homeolog antibody, defective in cullin neddylation 1 domain containing 1 antibody, dcun1d1 antibody, dcnl1 antibody, dcun1d1.L antibody, DCUN1D1 antibody, Dcun1d1 antibody

Background: DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.

Molecular Weight: 28 kDa (MW of target protein)