ACBD7 antibody (N-Term)

Catalog No. ABIN632041

Product Details anti-ACBD7 Antibody

Target: ACBD7 (Acyl-CoA Binding Domain Containing 7 (ACBD7))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACBD7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACBD7 antibody was raised against the N terminal of ACBD7

Purification: Affinity purified

Immunogen: ACBD7 antibody was raised using the N terminal of ACBD7 corresponding to a region with amino acids MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACBD7 Blocking Peptide, catalog no. 33R-5696, is also available for use as a blocking control in assays to test for specificity of this ACBD7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACBD7

Target: ACBD7 (Acyl-CoA Binding Domain Containing 7 (ACBD7))

Alternative Name: ACBD7 (ACBD7 Products)

Synonyms: zgc:114176 antibody, bA455B2.2 antibody, RGD1564164 antibody, 9230116B18Rik antibody, acyl-CoA binding domain containing 7 antibody, acyl-CoA binding domain containing 7 L homeolog antibody, acyl-Coenzyme A binding domain containing 7 antibody, ACBD7 antibody, acbd7 antibody, acbd7.L antibody, Acbd7 antibody

Background: The function of ACBD7 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 10 kDa (MW of target protein)