DCAF4 antibody (Middle Region)
-
- Target See all DCAF4 Antibodies
- DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DCAF4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WDR21 A antibody was raised against the middle region of WDR21
- Purification
- Affinity purified
- Immunogen
- WDR21 A antibody was raised using the middle region of WDR21 corresponding to a region with amino acids ARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS
- Top Product
- Discover our top product DCAF4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WDR21A Blocking Peptide, catalog no. 33R-1483, is also available for use as a blocking control in assays to test for specificity of this WDR21A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))
- Alternative Name
- WDR21A (DCAF4 Products)
- Synonyms
- Wdr21 antibody, 1110018E21Rik antibody, WDR21 antibody, WDR21A antibody, DDB1 and CUL4 associated factor 4 antibody, Dcaf4 antibody, DCAF4 antibody
- Background
- This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
- Molecular Weight
- 56 kDa (MW of target protein)
-