FAM13C antibody (N-Term)
-
- Target See all FAM13C products
- FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM13C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM13 C1 antibody was raised against the N terminal of FAM13 1
- Purification
- Affinity purified
- Immunogen
- FAM13 C1 antibody was raised using the N terminal of FAM13 1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM13C1 Blocking Peptide, catalog no. 33R-9039, is also available for use as a blocking control in assays to test for specificity of this FAM13C1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))
- Alternative Name
- FAM13C1 (FAM13C Products)
- Background
- FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.
- Molecular Weight
- 55 kDa (MW of target protein)
-