FAM13C antibody (N-Term)

Catalog No. ABIN632036

Product Details anti-FAM13C Antibody

Target: FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM13C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM13 C1 antibody was raised against the N terminal of FAM13 1

Purification: Affinity purified

Immunogen: FAM13 C1 antibody was raised using the N terminal of FAM13 1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM13C1 Blocking Peptide, catalog no. 33R-9039, is also available for use as a blocking control in assays to test for specificity of this FAM13C1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM13C

Target: FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))

Alternative Name: FAM13C1 (FAM13C Products)

Synonyms: FAM13C1 antibody, Fam13c1 antibody, RGD1310149 antibody, 1200015N20Rik antibody, C030038O19Rik antibody, mKIAA1796 antibody, family with sequence similarity 13 member C antibody, family with sequence similarity 13, member C antibody, FAM13C antibody, Fam13c antibody

Background: FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

Molecular Weight: 55 kDa (MW of target protein)