ANKS3 antibody (N-Term)
-
- Target See all ANKS3 Antibodies
- ANKS3 (Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ANKS3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ANKS3 antibody was raised against the N terminal of ANKS3
- Purification
- Affinity purified
- Immunogen
- ANKS3 antibody was raised using the N terminal of ANKS3 corresponding to a region with amino acids WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGW
- Top Product
- Discover our top product ANKS3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ANKS3 Blocking Peptide, catalog no. 33R-9953, is also available for use as a blocking control in assays to test for specificity of this ANKS3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKS3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANKS3 (Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3))
- Alternative Name
- ANKS3 (ANKS3 Products)
- Background
- ANKS3 contains 1 SAM (sterile alpha motif) domain and 6 ANK repeats. The exact function of ANKS3 remains unknown.
- Molecular Weight
- 72 kDa (MW of target protein)
-