ANKS3 antibody (N-Term)

Catalog No. ABIN632034

Product Details anti-ANKS3 Antibody

Target: ANKS3 (Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKS3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ANKS3 antibody was raised against the N terminal of ANKS3

Purification: Affinity purified

Immunogen: ANKS3 antibody was raised using the N terminal of ANKS3 corresponding to a region with amino acids WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKS3 Blocking Peptide, catalog no. 33R-9953, is also available for use as a blocking control in assays to test for specificity of this ANKS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKS3

Target: ANKS3 (Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3))

Alternative Name: ANKS3 (ANKS3 Products)

Synonyms: 2700067D09Rik antibody, C81345 antibody, mKIAA1977 antibody, RGD1305833 antibody, ankyrin repeat and sterile alpha motif domain containing 3 antibody, anks3 antibody, ANKS3 antibody, Anks3 antibody

Background: ANKS3 contains 1 SAM (sterile alpha motif) domain and 6 ANK repeats. The exact function of ANKS3 remains unknown.

Molecular Weight: 72 kDa (MW of target protein)