C11orf54 antibody (N-Term)
-
- Target See all C11orf54 Antibodies
- C11orf54 (Chromosome 11 Open Reading Frame 54 (C11orf54))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C11orf54 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C11 ORF54 antibody was raised against the N terminal Of C11 rf54
- Purification
- Affinity purified
- Immunogen
- C11 ORF54 antibody was raised using the N terminal Of C11 rf54 corresponding to a region with amino acids CPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEI
- Top Product
- Discover our top product C11orf54 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C11ORF54 Blocking Peptide, catalog no. 33R-1759, is also available for use as a blocking control in assays to test for specificity of this C11ORF54 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C11orf54 (Chromosome 11 Open Reading Frame 54 (C11orf54))
- Alternative Name
- C11ORF54 (C11orf54 Products)
- Synonyms
- PTD012 antibody, C11orf54 antibody, fb58g01 antibody, wu:fb58g01 antibody, wu:fc54a08 antibody, chromosome 11 open reading frame 54 antibody, chromosome 29 open reading frame, human C11orf54 antibody, chromosome 1 open reading frame, human C11orf54 antibody, chromosome 11 open reading frame 54 L homeolog antibody, RIKEN cDNA 4931406C07 gene antibody, zgc:85789 antibody, C11orf54 antibody, C29H11orf54 antibody, C1H11ORF54 antibody, c11orf54.L antibody, c11orf54 antibody, 4931406C07Rik antibody, zgc:85789 antibody
- Background
- C11orf54 exhibits ester hydrolase activity on the substrate p-nitrophenyl acetate.
- Molecular Weight
- 29 kDa (MW of target protein)
-