RAB40C antibody (N-Term)

Catalog No. ABIN632024

Product Details anti-RAB40C Antibody

Target: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB40C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB40 C antibody was raised against the N terminal of RAB40

Purification: Affinity purified

Immunogen: RAB40 C antibody was raised using the N terminal of RAB40 corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB40C Blocking Peptide, catalog no. 33R-7497, is also available for use as a blocking control in assays to test for specificity of this RAB40C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB40C

Target: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Alternative Name: RAB40C (RAB40C Products)

Background: RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molecular Weight: 31 kDa (MW of target protein)