Pellino 1 antibody

Catalog No. ABIN632023

Product Details anti-Pellino 1 Antibody

Target: Pellino 1 (PELI1) (Pellino E3 Ubiquitin Protein Ligase 1 (PELI1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Pellino 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PELI1 Blocking Peptide, catalog no. 33R-2740, is also available for use as a blocking control in assays to test for specificity of this PELI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PELI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Pellino 1

Target: Pellino 1 (PELI1) (Pellino E3 Ubiquitin Protein Ligase 1 (PELI1))

Alternative Name: PELI1 (PELI1 Products)

Synonyms: 2810468L03Rik antibody, A930031K15Rik antibody, AA409794 antibody, AI586297 antibody, D11Ertd676e antibody, peli1 antibody, peli1.L antibody, pellino1 antibody, xpellino1 antibody, wu:fd12d01 antibody, zgc:153297 antibody, pellino E3 ubiquitin protein ligase 1 antibody, pellino 1 antibody, pellino E3 ubiquitin protein ligase 1 S homeolog antibody, pellino E3 ubiquitin protein ligase 1b antibody, PELI1 antibody, Peli1 antibody, peli1.S antibody, peli1b antibody

Background: PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades