AKAP10 antibody

Catalog No. ABIN632020

Product Details anti-AKAP10 Antibody

Target: AKAP10 (A Kinase (PRKA) Anchor Protein 10 (AKAP10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKAP10 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: AKAP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKAP10 Blocking Peptide, catalog no. 33R-2735, is also available for use as a blocking control in assays to test for specificity of this AKAP10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKAP10

Target: AKAP10 (A Kinase (PRKA) Anchor Protein 10 (AKAP10))

Alternative Name: AKAP10 (AKAP10 Products)

Synonyms: MGC84612 antibody, AKAP10 antibody, fc10g11 antibody, wu:fc10g11 antibody, si:dkey-197m14.4 antibody, AKAP-10 antibody, D-AKAP-2 antibody, D-AKAP2 antibody, PRKA10 antibody, 1500031L16Rik antibody, B130049N18Rik antibody, D-akap2 antibody, Akap10 antibody, A-kinase anchoring protein 10 antibody, A-kinase anchoring protein 10 L homeolog antibody, A kinase (PRKA) anchor protein 10 antibody, AKAP10 antibody, akap10.L antibody, akap10 antibody, Akap10 antibody

Background: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA, therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.

Molecular Weight: 71 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling