ALAD antibody (N-Term)

Catalog No. ABIN632018

Product Details anti-ALAD Antibody

Target: ALAD (Aminolevulinate Dehydratase (ALAD))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALAD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALAD antibody was raised against the N terminal of ALAD

Purification: Affinity purified

Immunogen: ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALAD Blocking Peptide, catalog no. 33R-2375, is also available for use as a blocking control in assays to test for specificity of this ALAD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALAD

Target: ALAD (Aminolevulinate Dehydratase (ALAD))

Alternative Name: ALAD (ALAD Products)

Synonyms: DDBDRAFT_0190269 antibody, DDBDRAFT_0231415 antibody, DDB_0190269 antibody, DDB_0231415 antibody, ALAD antibody, ncf antibody, ALADH antibody, PBGS antibody, ALADR antibody, aminolevulinatedelta-dehydratase antibody, zgc:110219 antibody, Lv antibody, delta-aminolevulinate dehydratase antibody, aminolevulinate dehydratase antibody, delta-aminolevulinic acid dehydratase antibody, Delta-aminolevulinic acid dehydratase antibody, aminolevulinate dehydratase L homeolog antibody, aminolevulinate, delta-, dehydratase antibody, hemB antibody, ALAD antibody, PBGS antibody, STY0404 antibody, SAS1597 antibody, SACI_RS03725 antibody, PAAG_00299 antibody, VDBG_00315 antibody, HPPC_00830 antibody, MGYG_01952 antibody, hem2 antibody, alad.L antibody, Alad antibody, alad antibody

Background: The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway, zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.

Molecular Weight: 39 kDa (MW of target protein)