ALAD antibody (N-Term)
-
- Target See all ALAD Antibodies
- ALAD (Aminolevulinate Dehydratase (ALAD))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALAD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ALAD antibody was raised against the N terminal of ALAD
- Purification
- Affinity purified
- Immunogen
- ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP
- Top Product
- Discover our top product ALAD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALAD Blocking Peptide, catalog no. 33R-7682, is also available for use as a blocking control in assays to test for specificity of this ALAD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALAD (Aminolevulinate Dehydratase (ALAD))
- Alternative Name
- ALAD (ALAD Products)
- Synonyms
- DDBDRAFT_0190269 antibody, DDBDRAFT_0231415 antibody, DDB_0190269 antibody, DDB_0231415 antibody, ALAD antibody, ncf antibody, ALADH antibody, PBGS antibody, ALADR antibody, aminolevulinatedelta-dehydratase antibody, zgc:110219 antibody, Lv antibody, delta-aminolevulinate dehydratase antibody, aminolevulinate dehydratase antibody, delta-aminolevulinic acid dehydratase antibody, Delta-aminolevulinic acid dehydratase antibody, aminolevulinate dehydratase L homeolog antibody, aminolevulinate, delta-, dehydratase antibody, hemB antibody, ALAD antibody, PBGS antibody, STY0404 antibody, SAS1597 antibody, SACI_RS03725 antibody, PAAG_00299 antibody, VDBG_00315 antibody, HPPC_00830 antibody, MGYG_01952 antibody, hem2 antibody, alad.L antibody, Alad antibody, alad antibody
- Background
- The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway, zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.
- Molecular Weight
- 37 kDa (MW of target protein)
-