RIPK4 antibody (N-Term)

Catalog No. ABIN632015

Product Details anti-RIPK4 Antibody

Target: RIPK4 (Receptor-Interacting Serine-threonine Kinase 4 (RIPK4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RIPK4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RIPK4 antibody was raised against the N terminal of RIPK4

Purification: Affinity purified

Immunogen: RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RIPK4 Blocking Peptide, catalog no. 33R-1956, is also available for use as a blocking control in assays to test for specificity of this RIPK4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIPK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RIPK4

Target: RIPK4 (Receptor-Interacting Serine-threonine Kinase 4 (RIPK4))

Alternative Name: RIPK4 (RIPK4 Products)

Background: RIPK4 is a serine/threonine protein kinase that interacts with protein kinase C-delta. The protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation.

Molecular Weight: 86 kDa (MW of target protein)