RIPK4 antibody (N-Term)

Catalog No. ABIN632015

Product Details anti-RIPK4 Antibody

Target: RIPK4 (Receptor-Interacting Serine-threonine Kinase 4 (RIPK4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RIPK4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RIPK4 antibody was raised against the N terminal of RIPK4

Purification: Affinity purified

Immunogen: RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RIPK4 Blocking Peptide, catalog no. 33R-1956, is also available for use as a blocking control in assays to test for specificity of this RIPK4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIPK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RIPK4

Target: RIPK4 (Receptor-Interacting Serine-threonine Kinase 4 (RIPK4))

Alternative Name: RIPK4 (RIPK4 Products)

Synonyms: dik antibody, pkk antibody, rip4 antibody, ankk2 antibody, ankrd3 antibody, ripk4a antibody, MGC53701 antibody, MGC132134 antibody, zgc:55705 antibody, wu:fj80b10 antibody, ripk4b antibody, RIPK4 antibody, ANKK2 antibody, ANKRD3 antibody, DIK antibody, NKRD3 antibody, PKK antibody, PPS2 antibody, RIP4 antibody, 2310069J12Rik antibody, AI552420 antibody, Ankrd3 antibody, DIk antibody, receptor interacting serine/threonine kinase 4 L homeolog antibody, receptor-interacting serine-threonine kinase 4 antibody, receptor interacting serine/threonine kinase 4 antibody, receptor interacting serine/threonine kinase 4 S homeolog antibody, ripk4.L antibody, ripk4 antibody, RIPK4 antibody, ripk4.S antibody, Ripk4 antibody

Background: RIPK4 is a serine/threonine protein kinase that interacts with protein kinase C-delta. The protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation.

Molecular Weight: 86 kDa (MW of target protein)