FAM29A antibody (Middle Region)

Catalog No. ABIN632011

Product Details anti-FAM29A Antibody

Target: FAM29A (HAUS6) (HAUS Augmin-Like Complex, Subunit 6 (HAUS6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM29A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM29 A antibody was raised against the middle region of Fam29

Purification: Affinity purified

Immunogen: FAM29 A antibody was raised using the middle region of Fam29 corresponding to a region with amino acids RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM29A Blocking Peptide, catalog no. 33R-8198, is also available for use as a blocking control in assays to test for specificity of this FAM29A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM29A

Target: FAM29A (HAUS6) (HAUS Augmin-Like Complex, Subunit 6 (HAUS6))

Alternative Name: FAM29A (HAUS6 Products)

Synonyms: Dgt6 antibody, FAM29A antibody, fam29a antibody, wu:fd21a02 antibody, zgc:153242 antibody, family with sequence similarity 29, member A antibody, HAUS augmin like complex subunit 6 antibody, HAUS augmin-like complex, subunit 6 antibody, Fam29a antibody, HAUS6 antibody, haus6 antibody

Background: FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.

Molecular Weight: 108 kDa (MW of target protein)