TPD52L3 antibody (Middle Region)
-
- Target See all TPD52L3 Antibodies
- TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TPD52L3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TPD52 L3 antibody was raised against the middle region of TPD52 3
- Purification
- Affinity purified
- Immunogen
- TPD52 L3 antibody was raised using the middle region of TPD52 3 corresponding to a region with amino acids GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS
- Top Product
- Discover our top product TPD52L3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TPD52L3 Blocking Peptide, catalog no. 33R-3418, is also available for use as a blocking control in assays to test for specificity of this TPD52L3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPD50 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))
- Alternative Name
- TPD52L3 (TPD52L3 Products)
- Synonyms
- NYDSP25 antibody, hD55 antibody, 4931412G03Rik antibody, Trpd52l3 antibody, RGD1309391 antibody, TPD52L3 antibody, TRPD52L3 antibody, tumor protein D52 like 3 antibody, tumor protein D52-like 3 antibody, TPD52L3 antibody, Trpd52l3 antibody, Tpd52l3 antibody
- Background
- TPD52L3 encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.
- Molecular Weight
- 15 kDa (MW of target protein)
-