DESI1 antibody (Middle Region)

Catalog No. ABIN632008

Product Details anti-DESI1 Antibody

Target: DESI1 (PPPDE2) (PPPDE Peptidase Domain Containing 2 (PPPDE2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DESI1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: D15 WSU75 antibody was raised against the middle region of D15 su75

Purification: Affinity purified

Immunogen: D15 WSU75 antibody was raised using the middle region of D15 su75 corresponding to a region with amino acids FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

D15WSU75E Blocking Peptide, catalog no. 33R-2991, is also available for use as a blocking control in assays to test for specificity of this D15WSU75E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of D10 SU70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DESI1

Target: DESI1 (PPPDE2) (PPPDE Peptidase Domain Containing 2 (PPPDE2))

Alternative Name: D15WSU75E (PPPDE2 Products)

Synonyms: D15Wsu75e antibody, DESI2 antibody, DJ347H13.4 antibody, DeSI-1 antibody, FAM152B antibody, PPPDE2 antibody, AI427858 antibody, AI850401 antibody, Fam152b antibody, Pppde2 antibody, RGD1305776 antibody, fam152b antibody, pppde2 antibody, desumoylating isopeptidase 1 antibody, desumoylating isopeptidase 1 L homeolog antibody, DESI1 antibody, Desi1 antibody, desi1.L antibody

Background: The function of D15WSU75E protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 18 kDa (MW of target protein)