DESI1 antibody (Middle Region)
-
- Target See all DESI1 (PPPDE2) Antibodies
- DESI1 (PPPDE2) (PPPDE Peptidase Domain Containing 2 (PPPDE2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DESI1 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- D15 WSU75 antibody was raised against the middle region of D15 su75
- Purification
- Affinity purified
- Immunogen
- D15 WSU75 antibody was raised using the middle region of D15 su75 corresponding to a region with amino acids FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
D15WSU75E Blocking Peptide, catalog no. 33R-2991, is also available for use as a blocking control in assays to test for specificity of this D15WSU75E antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of D10 SU70 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DESI1 (PPPDE2) (PPPDE Peptidase Domain Containing 2 (PPPDE2))
- Alternative Name
- D15WSU75E (PPPDE2 Products)
- Background
- The function of D15WSU75E protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 18 kDa (MW of target protein)
-