UCK2 antibody (N-Term)

Catalog No. ABIN632007

Product Details anti-UCK2 Antibody

Target: UCK2 (Uridine-Cytidine Kinase 2 (UCK2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UCK2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UCK2 antibody was raised against the N terminal of UCK2

Purification: Affinity purified

Immunogen: UCK2 antibody was raised using the N terminal of UCK2 corresponding to a region with amino acids AGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UCK2 Blocking Peptide, catalog no. 33R-1189, is also available for use as a blocking control in assays to test for specificity of this UCK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UCK2

Target: UCK2 (Uridine-Cytidine Kinase 2 (UCK2))

Alternative Name: UCK2 (UCK2 Products)

Background: UCK2 catalyzes the phosphorylation of uridine monophosphate to uridine diphosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. In addition, an allele of this gene may play a role in mediating nonhumoral immunity to Hemophilus influenzae type B.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Feeding Behaviour