PSG6 antibody (N-Term)
-
- Target See all PSG6 Antibodies
- PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSG6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PSG6 antibody was raised against the N terminal of PSG6
- Purification
- Affinity purified
- Immunogen
- PSG6 antibody was raised using the N terminal of PSG6 corresponding to a region with amino acids VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV
- Top Product
- Discover our top product PSG6 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSG6 Blocking Peptide, catalog no. 33R-9675, is also available for use as a blocking control in assays to test for specificity of this PSG6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))
- Alternative Name
- PSG6 (PSG6 Products)
- Synonyms
- PSBG-10 antibody, PSBG-12 antibody, PSBG-6 antibody, PSG10 antibody, PSGGB antibody, PSG6 antibody, PSG3 antibody, pregnancy specific beta-1-glycoprotein 6 antibody, pregnancy-specific beta-1-glycoprotein 4 antibody, PSG6 antibody, LOC456082 antibody
- Background
- PSG6 may have a role in modulation of the innate immune system.
- Molecular Weight
- 47 kDa (MW of target protein)
-