SPAG6 antibody (Middle Region)
-
- Target See all SPAG6 Antibodies
- SPAG6 (Sperm Associated Antigen 6 (SPAG6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPAG6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SPAG6 antibody was raised against the middle region of SPAG6
- Purification
- Affinity purified
- Immunogen
- SPAG6 antibody was raised using the middle region of SPAG6 corresponding to a region with amino acids HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC
- Top Product
- Discover our top product SPAG6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPAG6 Blocking Peptide, catalog no. 33R-3872, is also available for use as a blocking control in assays to test for specificity of this SPAG6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPAG6 (Sperm Associated Antigen 6 (SPAG6))
- Alternative Name
- SPAG6 (SPAG6 Products)
- Synonyms
- Repro-SA-1 antibody, pf16 antibody, PF16 antibody, RGD1310892 antibody, zgc:91805 antibody, SPAG6 antibody, repro-sa-1 antibody, DKFZp459D035 antibody, sperm associated antigen 6 antibody, sperm associated antigen 6-like antibody, sperm associated antigen 6 L homeolog antibody, SPAG6 antibody, Spag6l antibody, Spag6 antibody, spag6 antibody, spag6.L antibody
- Background
- SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.
- Molecular Weight
- 56 kDa (MW of target protein)
-