LRRC49 antibody (N-Term)

Catalog No. ABIN631987

Product Details anti-LRRC49 Antibody

Target: LRRC49 (Leucine Rich Repeat Containing 49 (LRRC49))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC49 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC49 antibody was raised against the N terminal of LRRC49

Purification: Affinity purified

Immunogen: LRRC49 antibody was raised using the N terminal of LRRC49 corresponding to a region with amino acids KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC49 Blocking Peptide, catalog no. 33R-4703, is also available for use as a blocking control in assays to test for specificity of this LRRC49 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC49

Target: LRRC49 (Leucine Rich Repeat Containing 49 (LRRC49))

Alternative Name: LRRC49 (LRRC49 Products)

Synonyms: AI430817 antibody, AW050057 antibody, D430025H09Rik antibody, PGs4 antibody, p79 antibody, RGD1309466 antibody, leucine rich repeat containing 49 antibody, LRRC49 antibody, lrrc49 antibody, Lrrc49 antibody

Background: The function of LRRC49 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 79 kDa (MW of target protein)