LRRC49 antibody (N-Term)
-
- Target See all LRRC49 products
- LRRC49 (Leucine Rich Repeat Containing 49 (LRRC49))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRRC49 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRC49 antibody was raised against the N terminal of LRRC49
- Purification
- Affinity purified
- Immunogen
- LRRC49 antibody was raised using the N terminal of LRRC49 corresponding to a region with amino acids KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRC49 Blocking Peptide, catalog no. 33R-4703, is also available for use as a blocking control in assays to test for specificity of this LRRC49 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC49 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC49 (Leucine Rich Repeat Containing 49 (LRRC49))
- Alternative Name
- LRRC49 (LRRC49 Products)
- Synonyms
- AI430817 antibody, AW050057 antibody, D430025H09Rik antibody, PGs4 antibody, p79 antibody, RGD1309466 antibody, leucine rich repeat containing 49 antibody, LRRC49 antibody, lrrc49 antibody, Lrrc49 antibody
- Background
- The function of LRRC49 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 79 kDa (MW of target protein)
-